PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000924m
Common NameCARUB_v10000715mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 459aa    MW: 51391.1 Da    PI: 5.1107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000924mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-173683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Carubv10000924m 36 KGPWSSAEDDILIDYVNKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 83
                     79******************************************9986 PP

2Myb_DNA-binding53.84.4e-1789132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
  Carubv10000924m  89 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 132
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5283183IPR017930Myb domain
SuperFamilySSF466895.24E-3033130IPR009057Homeodomain-like
SMARTSM007176.5E-153585IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-233790IPR009057Homeodomain-like
CDDcd001671.02E-113883No hitNo description
PfamPF139217.8E-163999No hitNo description
PROSITE profilePS5129426.31684138IPR017930Myb domain
SMARTSM007172.7E-1788136IPR001005SANT/Myb domain
CDDcd001671.02E-1291132No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2591137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MSYTSTDDSD QNESPAAADD NGSDCRSRWE GSGLKKGPWS SAEDDILIDY VNKHGEGNWN  60
AVQKHTGLFR CGKSCRLRWA NHLRPNLKKG AFSQEEEQLI VELHAKMGNR WARMAAHLPG  120
RTDNEIKNYW NTRIKRRQRA GLPLYPPEMH VEVLEWSQEY AKSRIMGEDT RHSDFLQLGS  180
CQSNFFFDNL NFVTDIVPGA SSDLADTTGY KNLGNAASST RYGNFMTPIM TSSKRLWESE  240
LLYPGCSSTI KQEFPSPEQF QNTYPQKVSK TCSFSVPCDV DHPLFGNQHS PVMIPDSHTP  300
TDGIVPSSKP SYGEVKLELP SFQYSEATFD QWKKSSSPPH SDLLDPFDAY IQSPPPLTGR  360
EESDYFSNCD TGLLDMLLLE AKIRNNTTKN SLYKSCASTI PSADLGEVTV SQTKSEEFDN  420
SLKSLVRSEI STQQYADEIS LSQSLFYLPV SPSLEVVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-312513713127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4119690.0AF411969.1 Arabidopsis thaliana putative transcription factor MYB33 (MYB33) mRNA, complete cds.
GenBankAK1189370.0AK118937.1 Arabidopsis thaliana At5g06100 mRNA for putative transcription factor MYB33, complete cds, clone: RAFL21-27-I01.
GenBankAY5196160.0AY519616.1 Arabidopsis thaliana MYB transcription factor (At5g06100) mRNA, complete cds.
GenBankBT0060490.0BT006049.1 Arabidopsis thaliana clone U51311 putative MYB family transcription factor (At5g06100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287506.10.0hypothetical protein CARUB_v10000715mg
TrEMBLR0GU460.0R0GU46_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.10.0myb domain protein 33